PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 401aa    MW: 43936.2 Da    PI: 5.4821
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34814.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-185398147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd  l ++v +lG+++W++Iar ++ gR++k+c++rw + 
       KFK34814.1 53 KGPWSTEEDAVLTKLVSKLGPRNWSLIARGIP-GRSGKSCRLRWCNQ 98
                     79******************************.***********985 PP

2Myb_DNA-binding51.32.6e-16105149147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd  ++ +++ +G++ W+ Ia++++ gRt++ +k++w++ 
       KFK34814.1 105 RKPFSDEEDHMIISLHAVHGNK-WAVIAKMLP-GRTDNAIKNHWNST 149
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.47748103IPR017930Myb domain
SuperFamilySSF466895.24E-3150146IPR009057Homeodomain-like
SMARTSM007174.6E-1552101IPR001005SANT/Myb domain
PfamPF002497.6E-175398IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2554106IPR009057Homeodomain-like
CDDcd001674.70E-145597No hitNo description
PROSITE profilePS5129421.258104154IPR017930Myb domain
SMARTSM007173.4E-15104152IPR001005SANT/Myb domain
PfamPF002496.2E-15105149IPR001005SANT/Myb domain
CDDcd001672.42E-11107150No hitNo description
Gene3DG3DSA:1.10.10.608.6E-24107153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEGEETHQSL PLPSSAVDSD EGINAAIEAE LAELDSNGGG GGCGGGIIKS KVKGPWSTEE  60
DAVLTKLVSK LGPRNWSLIA RGIPGRSGKS CRLRWCNQLD PCLKRKPFSD EEDHMIISLH  120
AVHGNKWAVI AKMLPGRTDN AIKNHWNSTL RRKYADLWKS GQWMANSVTT AYVKKENVDG  180
VSNPSSKQQL PREEIDSPPK APQVNDVVMD DVADEPQEQA PIDSNGNAPI DSNAPVDSNV  240
QIESNVFRPV ARVGAFSVYN PTSQRNGYRN HNIVPCEGPL IQAAKPDSLA GKFLQSLCDE  300
PHIPSKCGHG CSTYPAETKF SGKSVLGPEF VDYEEPCAVF NQELISIATD LNNIAWIKSG  360
LDNTIVREAE QSLKMDNFNY NDPRVKFSGM MPRQDYFCAR S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-38521533104C-Myb DNA-Binding Domain
1mse_C3e-38521533104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878045.10.0hypothetical protein ARALYDRAFT_486007
TrEMBLA0A087GY620.0A0A087GY62_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.5__1999__AT3G55730.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.10.0myb domain protein 109